Human parathyroid hormone (1-84) (PTH) is produced by the parathyroid glands and regulates calcium and phosphate metabolism. PTH acts on PTHR1 receptors to stimulate bone formation and is used as a treatment for osteoporosis and hypoparathyroidism, a rare deficiency of parathyroid hormone [1,2]. There are limited published studies on full length PTH due the difficulty of obtaining the full sequence in high purity [2]. Others have used Boc-chemistry and combinations of Fmoc- based solid phase peptide synthesis (SPPS) with Native Chemical Ligation [3]. Here we explored PTH’s complete synthesis using fast protocols on an automated peptide synthesizer, to obtain high purity PTH peptide and it‘s analogs in a reduced amount of time which can be used to further understand PTH’s role in SAR studies or enhancing bioavailability and stability of PTH based therapeutics.
H-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRK KEDNVLVESHEKSLGEADKADVNVLTKAKSQ-NH2
Figure 1. PTH structure.